PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000112.1.g00019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family FAR1
Protein Properties Length: 752aa    MW: 86205.7 Da    PI: 6.4723
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000112.1.g00019.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR133.71.2e-1060121162
                            FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgC 62 
                                     ++Y++YAk+vGF + k +s++s+ ++e+++++f C ++g++++++++ + +   +   r  C
  FANhyb_rscf00000112.1.g00019.1  60 DYYKAYAKSVGFGTAKLSSRRSRASKEFIDAKFSCIRYGNKQQSDDAINPRLPLKLAARQAC 121
                                     59****************************************99988444333344444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.5E-860113IPR004330FAR1 DNA binding domain
PfamPF105517.3E-28232325IPR018289MULE transposase domain
PfamPF044342.5E-9512546IPR007527Zinc finger, SWIM-type
PROSITE profilePS5096610.855512548IPR007527Zinc finger, SWIM-type
SMARTSM005752.3E-8523550IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MGHMKSFNPI TSSFEVGEVD AKCRVDLNFP TSTTAMDAAA SIVEEPHDAM EFDSHEAAYD  60
YYKAYAKSVG FGTAKLSSRR SRASKEFIDA KFSCIRYGNK QQSDDAINPR LPLKLAARQA  120
CMSSAGRMGI DPHKNNDVRM RRRKNVNSVS SLFSAYQNVD CLESYLRNQH DKGRSLSLES  180
GDAQVLLECF MRMQEENPKF YYAVDLNEEH RLRNVFWVDA KGMEDYTNFS DVVFFDTTYF  240
TNKYKLPLVL FIGVNHHIQP TLMGCALIAD ETVYTFVWLM QTWLIAMGEQ APRVILSDQN  300
DAIKAAIGAV LPGTRHCFSL WHILEKMHGQ LEFLSMWLDT FMAKFNECIF KSWSEEQFEK  360
RWWKLIDEFN LRDIEWIQSL YRDRTHWVPT FMRDISFAGL SPTSRSTSLN SSFDKYFQVE  420
TSVPEFMERY RVILEDRYEE EAKANFDAWH ETPELKSPSP FEKQLALVYT QEVFKNFQVE  480
VLGAAACHLK KESEDMTTTT YSVKDIEDEQ NYTVEWNESK SDICCSCRSF EYKGYLCRHA  540
IVVLQMSGVF TVPAKYVLQR WTNTAMSRHA MGEKLDEVQF KVRRYNDLCR RAIILGEEGS  600
LSQESYDVAL CAIKEALKQC TSWNTSVESN AKPNDSAIDG VEEFQCGITS DDKISGPKVS  660
TPNKTPRRAG TGKVVARRGK GKLEGTRVGA QDNFHQMHQV SCDTRPPMLM QLHNVVPPQL  720
HNMVPSMFQN VAPAQFHNMG SPNPVQENRL PQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307850.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 4
SwissprotQ6NQJ70.0FRS4_ARATH; Protein FAR1-RELATED SEQUENCE 4
TrEMBLM5XKP20.0M5XKP2_PRUPE; Uncharacterized protein
STRINGVIT_09s0054g01830.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76320.20.0FAR1-related sequence 4